Random Protein Regions

Sequence Manipulation Suite:

Random Protein Regions

Random Protein Regions replaces regions of a protein sequence with random residues. Random sequences can be used to evaluate the significance of sequence analysis results.

Paste the raw sequence or one or more FASTA sequences into the text area below. Input limit is 500,000,000 characters.
>sample sequence MGHSLILFGIQSDAYAFIPTTNEVVALCCSKEYAECCTES
Enter the base positions or ranges of interest. Use ".." or "-" to represent a range, and use a comma to separate entries.

• The above ranges should be replaced with random residues preserved during the randomization process.

*This page requires JavaScript. See browser compatibility.
*You can mirror this page or use it off-line.

Sun 1 Oct 12:00:07 2023

Valid XHTML 1.0; Valid CSS