Fuzzy Search Protein

Sequence Manipulation Suite:

Fuzzy Search Protein

Fuzzy Search Protein accepts a protein sequence along with a query sequence and returns sites that are identical or similar to the query.

Enter the sequence to search (in raw sequence or FASTA format) into the text area below. Input limit is 2000 characters.
>test sequence GKGKYGLEAFNGKFVQTDGQLAGTANEQTQFTLIFTSGHLVLRDNNGRHLGVDSGTRVLK SSKPGLTKANYFILEDSCPQGAFEFGGKYASLKQGEDVSFKLLVDEDIEDTETFQLEFVE TDKYAIRVCDPKKNSRDAKFWKTVAAGIQANGNSKDQTDCQFSVEYNGNDMHVRAPGGKY
Enter the query sequence into the text area below. Input limit is 30 characters.


Use the following parameters to specify how hits are scored, and to control which hits are returned.

• Scoring matrix PAM30 PAM70 BLOSUM80 BLOSUM62 BLOSUM45
• Gap penalty 5 4 3 2 1 0 -1 -2 -3 -4 -5
• Report the the top 40 30 20 10 9 8 7 6 5 4 3 2 1 hits.

*This page requires JavaScript. See browser compatibility.
*You can mirror this page or use it off-line.

Sun 1 Oct 12:00:06 2023

Valid XHTML 1.0; Valid CSS