Allergenic Protein Sequence Searches

A sequence in FASTA format begins with a single-line description followed by a line of sequence data. The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column.

Example:

>gi|378405189|sp|P86137.2|NLTP1_ACTDE RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP1; Short=nsLTP1; AltName: Allergen=Act d 10.01
AVSCGQVDTALTPCLTYLTKGGTPSTQCCSGVRSLKSMTGTKVPDRQAACNCLKQAAARYQGIKDAAAALSQKCGVQLSVPISRSTDCSKIS

For an explanation of the FASTA search algorithm please see the Support page.

Please enter one or more search protein sequence below in FASTA format.

Sequence Entry
Search Options
Search Options: Choose the limit for identity cutoff
  • Note: Sliding 80mer Searches Prior to Septermber 12, 2007 may have identified matches of exactly 35% identity. However to be consistant with Codex 2005 the calculation of the cutoff value for a match has been changed to Greater than 35%.
  • Note 2: The sequences in the FASTA searchable database might vary from the sequences described in the public literature, as this database is not updated on a daily basis.
  • Note 3: We do not observe or log any protein sequences submitted through this website.
  • Note 4: The E score cutoff for the sliding 80mer search was changed from 100 to 10 on 15 January, 2015 as explained on the "About AllergenOnline" page.